VIP 10mg
$75.00
Research grade Vasoactive Intestinal Peptide. Research use only.
Lab: Freedom Diagnostics (independent third party). Certificates are batch-specific; the lot shown is the current shipping lot for the selected size.
Description
VIP 10 mg
Vasoactive Intestinal Peptide (VIP) is a naturally occurring 28-amino-acid signaling peptide found throughout the central and peripheral nervous systems. VIP is widely studied for its role in cellular communication, neuroendocrine signaling, vascular regulation, smooth muscle signaling, and immune-response pathways.
VIP interacts primarily with VPAC1 and VPAC2 receptors, making it an important research compound for investigating signaling pathways that connect the nervous, cardiovascular, gastrointestinal, respiratory, and immune systems.
Research Areas
- Neuroendocrine and neurological signaling
- VPAC1 and VPAC2 receptor activity
- Vascular and smooth muscle signaling
- Immune and inflammatory signaling pathways
- Gastrointestinal signaling
- Respiratory and pulmonary research
- Cellular cAMP signaling
Product Details
Compound: Vasoactive Intestinal Peptide (VIP)
Amount: 10 mg
Form: Lyophilized peptide
Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
For laboratory research purposes only. Not for human consumption.
Batch COA published for every lot.
Related products
-
- Sale!
- Metabolic Research Peptides, Research Peptides
MOTS-c
- Price range: $69.99 through $199.99
- Select options This product has multiple variants. The options may be chosen on the product page
-
- Sale!
- Research Peptides
Kisspeptin-10
- Original price was: $70.00.$45.99Current price is: $45.99.
- Add to cart
